SCOPe 2.06: Domain d1laba_: 1lab A:

Lineage for d1laba_ (1lab A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Lipoyl domain of dihydrolipoamide acetyltransferase [51238] (5 species)
   component of the pyruvate dehydrogenase complex

7. Species Bacillus stearothermophilus [TaxId:1422] [51239] (2 PDB entries)

8. Domain d1laba_: 1lab A: [28226]

Details for d1laba_

PDB Entry: 1lab

PDB Description: three-dimensional structure of the lipoyl domain from bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex

PDB Compounds: (A:) dihydrolipoamide acetyltransferase

SCOPe Domain Sequences for d1laba_:

Sequence; same for both SEQRES and ATOM records:

>d1laba_ b.84.1.1 (A:) Lipoyl domain of dihydrolipoamide acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
afefklpdigegihegeivkwfvkpgdevneddvlcevqndkavveipspvkgkvleilv
pegtvatvgqtlitldapgy

Timeline for d1laba_:

• d1laba_ first appeared (with stable ids) in SCOP 1.55, called d1lab__
  
• d1laba_ appears in SCOPe 2.05
  
• d1laba_ appears in SCOPe 2.07
  
• d1laba_ appears in the current release, SCOPe 2.08