Class b: All beta proteins [48724] (177 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) 7 to 8 strands in 2 beta-sheets |
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
Protein Protein H of glycine cleavage system [51236] (4 species) |
Species Pea (Pisum sativum) [TaxId:3888] [51237] (3 PDB entries) |
Domain d1dxmb_: 1dxm B: [28224] complexed with red |
PDB Entry: 1dxm (more details), 2.6 Å
SCOPe Domain Sequences for d1dxmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dxmb_ b.84.1.1 (B:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]} snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey tkfceeedaah
Timeline for d1dxmb_: