SCOPe 2.06: Domain d1dxmb_: 1dxm B:

Lineage for d1dxmb_ (1dxm B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Protein H of glycine cleavage system [51236] (4 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [51237] (3 PDB entries)

8. Domain d1dxmb_: 1dxm B: [28224]
   complexed with red

Details for d1dxmb_

PDB Entry: 1dxm, 2.6 Å

PDB Description: reduced form of the h protein from glycine decarboxylase complex

PDB Compounds: (B:) h protein

SCOPe Domain Sequences for d1dxmb_:

Sequence; same for both SEQRES and ATOM records:

>d1dxmb_ b.84.1.1 (B:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]}
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah

Timeline for d1dxmb_:

• d1dxmb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dxmb_ appears in SCOPe 2.05
  
• d1dxmb_ appears in SCOPe 2.07
  
• d1dxmb_ appears in the current release, SCOPe 2.08