Lineage for d1pq1b_ (1pq1 B:)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3046491Fold j.35: Transmembrane helical fragments [58517] (1 superfamily)
  4. 3046492Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) (S)
  5. 3046493Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins)
    the member of this family may be not related
  6. 3046525Protein BH3 domain of proapoptotic protein Bim [310747] (1 species)
    Pfam PF08945; interaction with Bcl-x described in 14499110
  7. 3046526Species Mouse (Mus musculus) [TaxId:10090] [311001] (1 PDB entry)
  8. 3046527Domain d1pq1b_: 1pq1 B: [282208]
    Other proteins in same PDB: d1pq1a_

Details for d1pq1b_

PDB Entry: 1pq1 (more details), 1.65 Å

PDB Description: Crystal structure of Bcl-xl/Bim
PDB Compounds: (B:) BCL2-like protein 11

SCOPe Domain Sequences for d1pq1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pq1b_ j.35.1.1 (B:) BH3 domain of proapoptotic protein Bim {Mouse (Mus musculus) [TaxId: 10090]}
dlrpeiriaqelrrigdefnetytrrvfandyr

SCOPe Domain Coordinates for d1pq1b_:

Click to download the PDB-style file with coordinates for d1pq1b_.
(The format of our PDB-style files is described here.)

Timeline for d1pq1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pq1a_