| Class j: Peptides [58231] (151 folds) |
| Fold j.35: Transmembrane helical fragments [58517] (1 superfamily) |
Superfamily j.35.1: Transmembrane helical fragments [58518] (1 family) ![]() |
| Family j.35.1.1: Transmembrane helical fragments [58519] (30 proteins) the member of this family may be not related |
| Protein BH3 domain of proapoptotic protein Bim [310747] (1 species) Pfam PF08945; interaction with Bcl-x described in 14499110 |
| Species Mouse (Mus musculus) [TaxId:10090] [311001] (1 PDB entry) |
| Domain d1pq1b_: 1pq1 B: [282208] Other proteins in same PDB: d1pq1a_ |
PDB Entry: 1pq1 (more details), 1.65 Å
SCOPe Domain Sequences for d1pq1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pq1b_ j.35.1.1 (B:) BH3 domain of proapoptotic protein Bim {Mouse (Mus musculus) [TaxId: 10090]}
dlrpeiriaqelrrigdefnetytrrvfandyr
Timeline for d1pq1b_: