SCOPe 2.05: Domain d1htpa_: 1htp A:

Lineage for d1htpa_ (1htp A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins)

6. Protein Protein H of glycine cleavage system [51236] (4 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [51237] (3 PDB entries)

8. Domain d1htpa_: 1htp A: [28220]
   complexed with oss

Details for d1htpa_

PDB Entry: 1htp, 2.2 Å

PDB Description: refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex

PDB Compounds: (A:) h-protein

SCOPe Domain Sequences for d1htpa_:

Sequence; same for both SEQRES and ATOM records:

>d1htpa_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]}
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah

Timeline for d1htpa_:

• d1htpa_ first appeared (with stable ids) in SCOP 1.55, called d1htp__
  
• d1htpa_ appears in SCOPe 2.04
  
• d1htpa_ appears in SCOPe 2.06
  
• d1htpa_ appears in the current release, SCOPe 2.08