SCOP 1.69: Domain d1htp__: 1htp -

Lineage for d1htp__ (1htp -)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (1 family)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)

6. Protein Protein H of glycine cleavage system [51236] (2 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [51237] (3 PDB entries)

8. Domain d1htp__: 1htp - [28220]

Details for d1htp__

PDB Entry: 1htp, 2.2 Å

PDB Description: refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex

SCOP Domain Sequences for d1htp__:

Sequence; same for both SEQRES and ATOM records:

>d1htp__ b.84.1.1 (-) Protein H of glycine cleavage system {Pea (Pisum sativum)}
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah

Timeline for d1htp__:

• d1htp__ first appeared (with stable ids) in SCOP 1.55
  
• d1htp__ appears in SCOP 1.67
  
• d1htp__ appears in SCOP 1.71
  
• d1htp__ appears in the current release, SCOPe 2.08, called d1htpa_