Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) 7 to 8 strands in 2 beta-sheets |
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (7 proteins) |
Protein Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) [51234] (1 species) |
Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [51235] (3 PDB entries) |
Domain d1dcza_: 1dcz A: [28219] |
PDB Entry: 1dcz (more details)
SCOPe Domain Sequences for d1dcza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dcza_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} agagkagegeipaplagtvskilvkegdtvkagqtvlvleamkmeteinaptdgkvekvl vkerdavqggqglikig
Timeline for d1dcza_: