Lineage for d1dd2a_ (1dd2 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471225Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 471226Superfamily b.84.1: Single hybrid motif [51230] (1 family) (S)
    7 to 8 strands in 2 beta-sheets
  5. 471227Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)
  6. 471228Protein Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) [51234] (1 species)
  7. 471229Species Propionibacterium freudenreichii, subsp. shermanii [TaxId:1744] [51235] (3 PDB entries)
  8. 471232Domain d1dd2a_: 1dd2 A: [28218]

Details for d1dd2a_

PDB Entry: 1dd2 (more details)

PDB Description: biotin carboxyl carrier domain of transcarboxylase (tc 1.3s)

SCOP Domain Sequences for d1dd2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd2a_ b.84.1.1 (A:) Biotin carboxyl carrier domain of transcarboxylase (TC 1.3S) {Propionibacterium freudenreichii, subsp. shermanii}
agagkagegeipaplagtvskilvkegdtvkagqtvlvleamkmeteinaptdgkvekvl
vkerdavqggqglikig

SCOP Domain Coordinates for d1dd2a_:

Click to download the PDB-style file with coordinates for d1dd2a_.
(The format of our PDB-style files is described here.)

Timeline for d1dd2a_: