| Class b: All beta proteins [48724] (174 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.1: Single hybrid motif [51230] (2 families) ![]() 7 to 8 strands in 2 beta-sheets |
| Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins) |
| Protein Biotinyl domain of acetyl-CoA carboxylase [51232] (1 species) |
| Species Escherichia coli [TaxId:562] [51233] (4 PDB entries) |
| Domain d3bdoa_: 3bdo A: [28217] |
PDB Entry: 3bdo (more details)
SCOPe Domain Sequences for d3bdoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]}
aaeisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqieadksgt
vkailvesgqpvefdeplvvie
Timeline for d3bdoa_: