Lineage for d1bdoa_ (1bdo A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332005Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1332006Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1332007Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)
  6. 1332013Protein Biotinyl domain of acetyl-CoA carboxylase [51232] (1 species)
  7. 1332014Species Escherichia coli [TaxId:562] [51233] (4 PDB entries)
  8. 1332015Domain d1bdoa_: 1bdo A: [28214]
    complexed with btn

Details for d1bdoa_

PDB Entry: 1bdo (more details), 1.8 Å

PDB Description: structure of the biotinyl domain of acetyl-coenzyme a carboxylase determined by mad phasing
PDB Compounds: (A:) acetyl-coa carboxylase

SCOPe Domain Sequences for d1bdoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdoa_ b.84.1.1 (A:) Biotinyl domain of acetyl-CoA carboxylase {Escherichia coli [TaxId: 562]}
eisghivrspmvgtfyrtpspdakafievgqkvnvgdtlciveamkmmnqieadksgtvk
ailvesgqpvefdeplvvie

SCOPe Domain Coordinates for d1bdoa_:

Click to download the PDB-style file with coordinates for d1bdoa_.
(The format of our PDB-style files is described here.)

Timeline for d1bdoa_: