SCOPe 2.06: Domain d1qiue2: 1qiu E:319-395

Lineage for d1qiue2 (1qiu E:319-395)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.83: Triple beta-spiral [51224] (1 superfamily)
trimer formed by the interlocking beta-hairpin repeat units
Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (3 families)
Family b.83.1.1: Adenovirus [51226] (1 protein)
Protein Adenovirus [51227] (1 species)
Species Human adenovirus type 2 [TaxId:10515] [51228] (3 PDB entries)
Uniprot P10104
Domain d1qiue2: 1qiu E:319-395 [28212]
Other proteins in same PDB: d1qiua1, d1qiub1, d1qiuc1, d1qiud1, d1qiue1, d1qiuf1

Details for d1qiue2

PDB Entry: 1qiu (more details), 2.4 Å

PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres

PDB Compounds: (E:) adenovirus fibre

SCOPe Domain Sequences for d1qiue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qiue2 b.83.1.1 (E:319-395) Adenovirus {Human adenovirus type 2 [TaxId: 10515]}
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitignkn

SCOPe Domain Coordinates for d1qiue2:

Click to download the PDB-style file with coordinates for d1qiue2.
(The format of our PDB-style files is described here.)

Timeline for d1qiue2: