Lineage for d1qiud2 (1qiu D:319-395)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471199Fold b.83: Triple beta-spiral [51224] (1 superfamily)
    trimer formed by the interlocking beta-hairpin repeat units
  4. 471200Superfamily b.83.1: Fibre shaft of virus attachment proteins [51225] (2 families) (S)
  5. 471201Family b.83.1.1: Adenovirus [51226] (1 protein)
  6. 471202Protein Adenovirus [51227] (1 species)
  7. 471203Species Human adenovirus type 2 [TaxId:10515] [51228] (3 PDB entries)
  8. 471216Domain d1qiud2: 1qiu D:319-395 [28211]
    Other proteins in same PDB: d1qiua1, d1qiub1, d1qiuc1, d1qiud1, d1qiue1, d1qiuf1

Details for d1qiud2

PDB Entry: 1qiu (more details), 2.4 Å

PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres

SCOP Domain Sequences for d1qiud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qiud2 b.83.1.1 (D:319-395) Adenovirus {Human adenovirus type 2}
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitignkn

SCOP Domain Coordinates for d1qiud2:

Click to download the PDB-style file with coordinates for d1qiud2.
(The format of our PDB-style files is described here.)

Timeline for d1qiud2:

471216
d1qiud2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1qiud1