Lineage for d1qiub2 (1qiu B:319-395)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17996Fold b.83: Triple beta-spiral [51224] (1 superfamily)
  4. 17997Superfamily b.83.1: Adenovirus fibre shaft [51225] (1 family) (S)
  5. 17998Family b.83.1.1: Adenovirus fibre shaft [51226] (1 protein)
  6. 17999Protein Adenovirus fibre shaft [51227] (1 species)
  7. 18000Species Human adenovirus type 2 [TaxId:10515] [51228] (1 PDB entry)
  8. 18002Domain d1qiub2: 1qiu B:319-395 [28209]
    Other proteins in same PDB: d1qiua1, d1qiub1, d1qiuc1, d1qiud1, d1qiue1, d1qiuf1

Details for d1qiub2

PDB Entry: 1qiu (more details), 2.4 Å

PDB Description: a triple beta-spiral in the adenovirus fibre shaft reveals a new structural motif for biological fibres

SCOP Domain Sequences for d1qiub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qiub2 b.83.1.1 (B:319-395) Adenovirus fibre shaft {Human adenovirus type 2}
vsikkssglnfdntaiainagkglefdtntsespdinpiktkigsgidynengamitklg
aglsfdnsgaitignkn

SCOP Domain Coordinates for d1qiub2:

Click to download the PDB-style file with coordinates for d1qiub2.
(The format of our PDB-style files is described here.)

Timeline for d1qiub2: