Lineage for d1qawh_ (1qaw H:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171721Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 171927Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
  5. 171928Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 171929Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 171930Species Bacillus stearothermophilus [TaxId:1422] [51223] (4 PDB entries)
  8. 171982Domain d1qawh_: 1qaw H: [28204]

Details for d1qawh_

PDB Entry: 1qaw (more details), 2.5 Å

PDB Description: Regulatory Features of the TRP Operon and the Crystal Structure of the TRP RNA-Binding Attenuation Protein from Bacillus Stearothermophilus.

SCOP Domain Sequences for d1qawh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qawh_ b.82.5.1 (H:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
hgvieseg

SCOP Domain Coordinates for d1qawh_:

Click to download the PDB-style file with coordinates for d1qawh_.
(The format of our PDB-style files is described here.)

Timeline for d1qawh_: