Class b: All beta proteins [48724] (144 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.5: TRAP-like [51219] (2 families) shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains |
Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein) oligomeric ring consists of 11 single-domain subunits |
Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [51223] (7 PDB entries) |
Domain d1qawe_: 1qaw E: [28201] |
PDB Entry: 1qaw (more details), 2.5 Å
SCOP Domain Sequences for d1qawe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qawe_ b.82.5.1 (E:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus} sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr hgviesegk
Timeline for d1qawe_: