Lineage for d1c9st_ (1c9s T:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381159Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 381552Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 381553Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
    oligomeric ring consists of 11 single-domain subunits
  6. 381554Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 381555Species Bacillus stearothermophilus [TaxId:1422] [51223] (7 PDB entries)
  8. 381619Domain d1c9st_: 1c9s T: [28194]

Details for d1c9st_

PDB Entry: 1c9s (more details), 1.9 Å

PDB Description: crystal structure of a complex of trp rna-binding attenuation protein with a 53-base single stranded rna containing eleven gag triplets separated by au dinucleotides

SCOP Domain Sequences for d1c9st_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9st_ b.82.5.1 (T:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
trhgvieseg

SCOP Domain Coordinates for d1c9st_:

Click to download the PDB-style file with coordinates for d1c9st_.
(The format of our PDB-style files is described here.)

Timeline for d1c9st_: