Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.5: TRAP-like [51219] (2 families) shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains |
Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins) oligomeric ring consists of 11 single-domain subunits automatically mapped to Pfam PF02081 |
Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species) |
Species Bacillus stearothermophilus [TaxId:1422] [51223] (11 PDB entries) |
Domain d1c9si_: 1c9s I: [28183] protein/RNA complex; complexed with trp |
PDB Entry: 1c9s (more details), 1.9 Å
SCOPe Domain Sequences for d1c9si_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c9si_ b.82.5.1 (I:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]} sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr hgviesegk
Timeline for d1c9si_: