Lineage for d1c9sg_ (1c9s G:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17821Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies)
  4. 17936Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
  5. 17937Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 17938Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 17939Species Bacillus stearothermophilus [TaxId:1422] [51223] (2 PDB entries)
  8. 17946Domain d1c9sg_: 1c9s G: [28181]

Details for d1c9sg_

PDB Entry: 1c9s (more details), 1.9 Å

PDB Description: crystal structure of a complex of trp rna-binding attenuation protein with a 53-base single stranded rna containing eleven gag triplets separated by au dinucleotides

SCOP Domain Sequences for d1c9sg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9sg_ b.82.5.1 (G:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus}
nsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqt
rhgviesegk

SCOP Domain Coordinates for d1c9sg_:

Click to download the PDB-style file with coordinates for d1c9sg_.
(The format of our PDB-style files is described here.)

Timeline for d1c9sg_: