Lineage for d1wapt_ (1wap T:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234509Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 234742Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
    shorter variant of double-helix
  5. 234743Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 234744Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 234823Species Bacillus subtilis [TaxId:1423] [51222] (1 PDB entry)
  8. 234843Domain d1wapt_: 1wap T: [28172]

Details for d1wapt_

PDB Entry: 1wap (more details), 1.8 Å

PDB Description: trp rna-binding attenuation protein in complex with l-tryptophan

SCOP Domain Sequences for d1wapt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wapt_ b.82.5.1 (T:) Trp RNA-binding attenuation protein (TRAP) {Bacillus subtilis}
dfvvikavedgvnvigltrgtdtkfhhsekldkgeviiaqftehtsaikvrgealiqtay
gemksek

SCOP Domain Coordinates for d1wapt_:

Click to download the PDB-style file with coordinates for d1wapt_.
(The format of our PDB-style files is described here.)

Timeline for d1wapt_: