Lineage for d1wapo_ (1wap O:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63617Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 63753Superfamily b.82.5: Trp RNA-binding attenuation protein (TRAP) [51219] (1 family) (S)
  5. 63754Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
  6. 63755Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 63790Species Bacillus subtilis [TaxId:1423] [51222] (1 PDB entry)
  8. 63805Domain d1wapo_: 1wap O: [28167]

Details for d1wapo_

PDB Entry: 1wap (more details), 1.8 Å

PDB Description: trp rna-binding attenuation protein in complex with l-tryptophan

SCOP Domain Sequences for d1wapo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wapo_ b.82.5.1 (O:) Trp RNA-binding attenuation protein (TRAP) {Bacillus subtilis}
dfvvikavedgvnvigltrgtdtkfhhsekldkgeviiaqftehtsaikvrgealiqtay
gemksek

SCOP Domain Coordinates for d1wapo_:

Click to download the PDB-style file with coordinates for d1wapo_.
(The format of our PDB-style files is described here.)

Timeline for d1wapo_: