Lineage for d1wapg_ (1wap G:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 471004Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 471005Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (1 protein)
    oligomeric ring consists of 11 single-domain subunits
  6. 471006Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)
  7. 471151Species Bacillus subtilis [TaxId:1423] [51222] (1 PDB entry)
  8. 471158Domain d1wapg_: 1wap G: [28159]

Details for d1wapg_

PDB Entry: 1wap (more details), 1.8 Å

PDB Description: trp rna-binding attenuation protein in complex with l-tryptophan

SCOP Domain Sequences for d1wapg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wapg_ b.82.5.1 (G:) Trp RNA-binding attenuation protein (TRAP) {Bacillus subtilis}
dfvvikavedgvnvigltrgtdtkfhhsekldkgeviiaqftehtsaikvrgealiqtay
gemksek

SCOP Domain Coordinates for d1wapg_:

Click to download the PDB-style file with coordinates for d1wapg_.
(The format of our PDB-style files is described here.)

Timeline for d1wapg_: