SCOPe 2.05: Domain d2araa_: 2ara A:

Lineage for d2araa_ (2ara A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.4: Regulatory protein AraC [51215] (1 family)
   automatically mapped to Pfam PF02311

5. Family b.82.4.1: Regulatory protein AraC [51216] (1 protein)

6. Protein Regulatory protein AraC [51217] (1 species)
   contains an alpha-hairpin in the C-terminal extension

7. Species Escherichia coli [TaxId:562] [51218] (4 PDB entries)
   Uniprot P03021

8. Domain d2araa_: 2ara A: [28152]

Details for d2araa_

PDB Entry: 2ara, 2.8 Å

PDB Description: apo form of escherichia coli regulatory protein arac

PDB Compounds: (A:) arac

SCOPe Domain Sequences for d2araa_:

Sequence; same for both SEQRES and ATOM records:

>d2araa_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]}
lvagltpieangyldffidrplgmkgyilnltirgqgvvknqgrefvcrpgdillfppge
ihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeahqphfsdlfgqii
nagqgegrysellainlleqlllrrmeai

Timeline for d2araa_:

• d2araa_ first appeared (with stable ids) in SCOP 1.55, called d2ara__
  
• d2araa_ appears in SCOPe 2.04
  
• d2araa_ appears in SCOPe 2.06
  
• d2araa_ appears in the current release, SCOPe 2.08