SCOP 1.75: Domain d2aacb_: 2aac B:

Lineage for d2aacb_ (2aac B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.4: Regulatory protein AraC [51215] (1 family)

5. Family b.82.4.1: Regulatory protein AraC [51216] (1 protein)

6. Protein Regulatory protein AraC [51217] (1 species)
   contains an alpha-hairpin in the C-terminal extension

7. Species Escherichia coli [TaxId:562] [51218] (4 PDB entries)
   Uniprot P03021

8. Domain d2aacb_: 2aac B: [28151]
   complexed with acy, fcb

Details for d2aacb_

PDB Entry: 2aac, 1.6 Å

PDB Description: escherchia coli gene regulatory protein arac complexed with d-fucose

PDB Compounds: (B:) arac

SCOP Domain Sequences for d2aacb_:

Sequence; same for both SEQRES and ATOM records:

>d2aacb_ b.82.4.1 (B:) Regulatory protein AraC {Escherichia coli [TaxId: 562]}
ndpllpgysfnahlvagltpieangyldffidrplgmkgyilnltirgqgvvknqgrefv
crpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdea
hqphfsdlfgqiinagqgegrysellainlleqlllrrmeain

Timeline for d2aacb_:

• d2aacb_ first appeared (with stable ids) in SCOP 1.55
  
• d2aacb_ appears in SCOP 1.73
  
• d2aacb_ appears in SCOPe 2.01
  
• d2aacb_ appears in the current release, SCOPe 2.08