SCOPe 2.08: Domain d2arcb_: 2arc B:

Lineage for d2arcb_ (2arc B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.4: Regulatory protein AraC [51215] (1 family)
   automatically mapped to Pfam PF02311

5. Family b.82.4.1: Regulatory protein AraC [51216] (1 protein)

6. Protein Regulatory protein AraC [51217] (1 species)
   contains an alpha-hairpin in the C-terminal extension

7. Species Escherichia coli [TaxId:562] [51218] (4 PDB entries)
   Uniprot P03021

8. Domain d2arcb_: 2arc B: [28149]
   complexed with ara

Details for d2arcb_

PDB Entry: 2arc, 1.5 Å

PDB Description: escherichia coli regulatory protein arac complexed with l-arabinose

PDB Compounds: (B:) arabinose operon regulatory protein

SCOPe Domain Sequences for d2arcb_:

Sequence; same for both SEQRES and ATOM records:

>d2arcb_ b.82.4.1 (B:) Regulatory protein AraC {Escherichia coli [TaxId: 562]}
dpllpgysfnahlvagltpieangyldffidrplgmkgyilnltirgqgvvknqgrefvc
rpgdillfppgeihhygrhpearewyhqwvyfrpraywhewlnwpsifantgffrpdeah
qphfsdlfgqiinagqgegrysellainlleqlllrrmeaines

Timeline for d2arcb_:

• d2arcb_ first appeared (with stable ids) in SCOP 1.55
  
• d2arcb_ appears in SCOPe 2.07