Lineage for d1rgs_2 (1rgs 243-376)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies) 
Superfamily b.82.3: cAMP-binding domain-like [51206] (2 families) 
Family b.82.3.2: cAMP-binding domain [51210] (2 proteins) 
Protein Regulatory subunit of Protein kinase A [51213] (1 species) Species Cow (Bos taurus) [TaxId:9913] [51214] (1 PDB entry) 
Domain d1rgs_2: 1rgs 243-376 [28147]
Details for d1rgs_2
PDB Entry: 1rgs (more details), 2.8 Å
PDB Description: regulatory subunit of camp dependent protein kinase
SCOP Domain Sequences for d1rgs_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rgs_2 b.82.3.2 (243-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus)}
myeeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiilegsaavlq
rrseneefvevgrlgpsdyfgeiallmnrpraatvvargplkcvkldrprfervlgpcsd
ilkrniqqynsfvs
SCOP Domain Coordinates for d1rgs_2:
Click to download the PDB-style file with coordinates for d1rgs_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rgs_2:
- d1rgs_2 appears in SCOP 1.57
- d1rgs_2 appears in the current release, SCOPe 2.08, called d1rgsa2
View in 3D
