SCOPe 2.08: Domain d1rgsa2: 1rgs A:245-376

Lineage for d1rgsa2 (1rgs A:245-376)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Regulatory subunit of Protein kinase A [51213] (2 species)
   duplication: consists of two similar domains

7. Species Cow (Bos taurus) [TaxId:9913] [51214] (5 PDB entries)
   Uniprot P00514 109-376

8. Domain d1rgsa2: 1rgs A:245-376 [28147]
   complexed with cmp

Details for d1rgsa2

PDB Entry: 1rgs, 2.8 Å

PDB Description: regulatory subunit of camp dependent protein kinase

PDB Compounds: (A:) camp dependent protein kinase

SCOPe Domain Sequences for d1rgsa2:

Sequence; same for both SEQRES and ATOM records:

>d1rgsa2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]}
eeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiilegsaavlqrr
seneefvevgrlgpsdyfgeiallmnrpraatvvargplkcvkldrprfervlgpcsdil
krniqqynsfvs

Timeline for d1rgsa2:

• d1rgsa2 first appeared (with stable ids) in SCOP 1.55, called d1rgs_2
  
• d1rgsa2 appears in SCOPe 2.07