Lineage for d1rgs_1 (1rgs 113-242)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17821Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies)
  4. 17901Superfamily b.82.3: cAMP-binding domain-like [51206] (2 families) (S)
  5. 17907Family b.82.3.2: cAMP-binding domain [51210] (2 proteins)
  6. 17923Protein Regulatory subunit of Protein kinase A [51213] (1 species)
  7. 17924Species Cow (Bos taurus) [TaxId:9913] [51214] (1 PDB entry)
  8. 17925Domain d1rgs_1: 1rgs 113-242 [28146]

Details for d1rgs_1

PDB Entry: 1rgs (more details), 2.8 Å

PDB Description: regulatory subunit of camp dependent protein kinase

SCOP Domain Sequences for d1rgs_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgs_1 b.82.3.2 (113-242) Regulatory subunit of Protein kinase A {Cow (Bos taurus)}
rkvipkdyktmaalakaieknvlfshlddnersdifdamfpvsfiagetviqqgdegdnf
yvidqgemdvyvnnewatsvgeggsfgelaliygtpraatvkaktnvklwgidrdsyrri
lmgstlrkrk

SCOP Domain Coordinates for d1rgs_1:

Click to download the PDB-style file with coordinates for d1rgs_1.
(The format of our PDB-style files is described here.)

Timeline for d1rgs_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rgs_2