| Class b: All beta proteins [48724] (174 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
| Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
| Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species) |
| Species Escherichia coli [TaxId:562] [51212] (28 PDB entries) |
| Domain d1g6na2: 1g6n A:7-137 [28139] Other proteins in same PDB: d1g6na1, d1g6nb1 complexed with cmp |
PDB Entry: 1g6n (more details), 2.1 Å
SCOPe Domain Sequences for d1g6na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6na2 b.82.3.2 (A:7-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
tsekvgnlafl
Timeline for d1g6na2: