SCOP 1.75: Domain d1cgpb2: 1cgp B:9-137

Lineage for d1cgpb2 (1cgp B:9-137)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (12 proteins)
   Pfam PF00027

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (19 PDB entries)

8. Domain d1cgpb2: 1cgp B:9-137 [28136]
   Other proteins in same PDB: d1cgpa1, d1cgpb1
   protein/DNA complex; complexed with cmp

Details for d1cgpb2

PDB Entry: 1cgp, 3 Å

PDB Description: catabolite gene activator protein (cap)/dna complex + adenosine-3',5'- cyclic-monophosphate

PDB Compounds: (B:) protein (catabolite gene activator protein (cap))

SCOP Domain Sequences for d1cgpb2:

Sequence; same for both SEQRES and ATOM records:

>d1cgpb2 b.82.3.2 (B:9-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
ptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqgd
figelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvts
ekvgnlafl

Timeline for d1cgpb2:

• d1cgpb2 first appeared (with stable ids) in SCOP 1.55
  
• d1cgpb2 appears in SCOP 1.73
  
• d1cgpb2 appears in SCOPe 2.01
  
• d1cgpb2 appears in the current release, SCOPe 2.08