Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.1: CO-sensing protein CooA, N-terminal domain [51207] (1 protein) heme-binding domain |
Protein CO-sensing protein CooA, N-terminal domain [51208] (1 species) |
Species Rhodospirillum rubrum [TaxId:1085] [51209] (1 PDB entry) |
Domain d1ft9a2: 1ft9 A:2-133 [28131] Other proteins in same PDB: d1ft9a1, d1ft9b1 complexed with hem |
PDB Entry: 1ft9 (more details), 2.6 Å
SCOPe Domain Sequences for d1ft9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} pprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgeer eislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgralt scmrtiedlmfh
Timeline for d1ft9a2: