SCOPe 2.06: Domain d1ft9a2: 1ft9 A:2-133

Lineage for d1ft9a2 (1ft9 A:2-133)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.1: CO-sensing protein CooA, N-terminal domain [51207] (1 protein)
   heme-binding domain

6. Protein CO-sensing protein CooA, N-terminal domain [51208] (1 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [51209] (1 PDB entry)

8. Domain d1ft9a2: 1ft9 A:2-133 [28131]
   Other proteins in same PDB: d1ft9a1, d1ft9b1
   complexed with hem

Details for d1ft9a2

PDB Entry: 1ft9, 2.6 Å

PDB Description: structure of the reduced (feii) co-sensing protein from r. rubrum

PDB Compounds: (A:) carbon monoxide oxidation system transcription regulator

SCOPe Domain Sequences for d1ft9a2:

Sequence; same for both SEQRES and ATOM records:

>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]}
pprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgeer
eislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgralt
scmrtiedlmfh

Timeline for d1ft9a2:

• d1ft9a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ft9a2 appears in SCOPe 2.05
  
• d1ft9a2 appears in SCOPe 2.07
  
• d1ft9a2 appears in the current release, SCOPe 2.08