Lineage for d1ft9a2 (1ft9 A:2-133)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816659Family b.82.3.1: CO-sensing protein CooA, N-terminal domain [51207] (1 protein)
    heme-binding domain
  6. 2816660Protein CO-sensing protein CooA, N-terminal domain [51208] (1 species)
  7. 2816661Species Rhodospirillum rubrum [TaxId:1085] [51209] (1 PDB entry)
  8. 2816662Domain d1ft9a2: 1ft9 A:2-133 [28131]
    Other proteins in same PDB: d1ft9a1, d1ft9b1
    complexed with hem

Details for d1ft9a2

PDB Entry: 1ft9 (more details), 2.6 Å

PDB Description: structure of the reduced (feii) co-sensing protein from r. rubrum
PDB Compounds: (A:) carbon monoxide oxidation system transcription regulator

SCOPe Domain Sequences for d1ft9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]}
pprfnianvllspdgetffrgfrskihakgslvctgegdengvfvvvdgrlrvylvgeer
eislfyltsgdmfcmhsgclveatertevrfadirtfeqklqtcpsmawgliailgralt
scmrtiedlmfh

SCOPe Domain Coordinates for d1ft9a2:

Click to download the PDB-style file with coordinates for d1ft9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ft9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ft9a1