Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.2: Clavaminate synthase [51203] (2 proteins) |
Protein Clavaminate synthase [51204] (1 species) |
Species Streptomyces clavuligerus [TaxId:1901] [51205] (5 PDB entries) |
Domain d1ds0a_: 1ds0 A: [28129] complexed with act, so4 |
PDB Entry: 1ds0 (more details), 1.63 Å
SCOPe Domain Sequences for d1ds0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ds0a_ b.82.2.2 (A:) Clavaminate synthase {Streptomyces clavuligerus [TaxId: 1901]} tsvdctaygpelralaarlprtpradlyafldaahtaaaslpgalataldtfnaegsedg hlllrglpveadadlpttpsstpapedrslltmeamlglvgrrlglhtgyrelrsgtvyh dvypspgahhlssetsetllefhtemayhrlqpnyvmlacsradhertaatlvasvrkal plldertrarlldrrmpccvdvafrggvddpgaiaqvkplygdaddpflgydrellaped padkeavaalskaldevteavylepgdllivdnfrtthartpfsprwdgkdrwlhrvyir tdrngqlsggeragdvvaftprg
Timeline for d1ds0a_: