Lineage for d1ds0a_ (1ds0 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815541Family b.82.2.2: Clavaminate synthase [51203] (2 proteins)
  6. 2815542Protein Clavaminate synthase [51204] (1 species)
  7. 2815543Species Streptomyces clavuligerus [TaxId:1901] [51205] (5 PDB entries)
  8. 2815546Domain d1ds0a_: 1ds0 A: [28129]
    complexed with act, so4

Details for d1ds0a_

PDB Entry: 1ds0 (more details), 1.63 Å

PDB Description: crystal structure of clavaminate synthase
PDB Compounds: (A:) clavaminate synthase 1

SCOPe Domain Sequences for d1ds0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ds0a_ b.82.2.2 (A:) Clavaminate synthase {Streptomyces clavuligerus [TaxId: 1901]}
tsvdctaygpelralaarlprtpradlyafldaahtaaaslpgalataldtfnaegsedg
hlllrglpveadadlpttpsstpapedrslltmeamlglvgrrlglhtgyrelrsgtvyh
dvypspgahhlssetsetllefhtemayhrlqpnyvmlacsradhertaatlvasvrkal
plldertrarlldrrmpccvdvafrggvddpgaiaqvkplygdaddpflgydrellaped
padkeavaalskaldevteavylepgdllivdnfrtthartpfsprwdgkdrwlhrvyir
tdrngqlsggeragdvvaftprg

SCOPe Domain Coordinates for d1ds0a_:

Click to download the PDB-style file with coordinates for d1ds0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ds0a_: