SCOPe 2.08: Domain d1ds0a_: 1ds0 A:

Lineage for d1ds0a_ (1ds0 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.2: Clavaminate synthase [51203] (2 proteins)

6. Protein Clavaminate synthase [51204] (1 species)

7. Species Streptomyces clavuligerus [TaxId:1901] [51205] (5 PDB entries)

8. Domain d1ds0a_: 1ds0 A: [28129]
   complexed with act, so4

Details for d1ds0a_

PDB Entry: 1ds0, 1.63 Å

PDB Description: crystal structure of clavaminate synthase

PDB Compounds: (A:) clavaminate synthase 1

SCOPe Domain Sequences for d1ds0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ds0a_ b.82.2.2 (A:) Clavaminate synthase {Streptomyces clavuligerus [TaxId: 1901]}
tsvdctaygpelralaarlprtpradlyafldaahtaaaslpgalataldtfnaegsedg
hlllrglpveadadlpttpsstpapedrslltmeamlglvgrrlglhtgyrelrsgtvyh
dvypspgahhlssetsetllefhtemayhrlqpnyvmlacsradhertaatlvasvrkal
plldertrarlldrrmpccvdvafrggvddpgaiaqvkplygdaddpflgydrellaped
padkeavaalskaldevteavylepgdllivdnfrtthartpfsprwdgkdrwlhrvyir
tdrngqlsggeragdvvaftprg

Timeline for d1ds0a_:

• d1ds0a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ds0a_ appears in SCOPe 2.07