Lineage for d1drya_ (1dry A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2070865Family b.82.2.2: Clavaminate synthase [51203] (1 protein)
  6. 2070866Protein Clavaminate synthase [51204] (1 species)
  7. 2070867Species Streptomyces clavuligerus [TaxId:1901] [51205] (5 PDB entries)
  8. 2070869Domain d1drya_: 1dry A: [28128]
    complexed with aag, akg, fe2, gol, so4

Details for d1drya_

PDB Entry: 1dry (more details), 1.4 Å

PDB Description: crystal structure of clavaminate synthase in complex with fe(ii), 2-oxoglutarate and n-alpha-l-acetyl arginine
PDB Compounds: (A:) clavaminate synthase 1

SCOPe Domain Sequences for d1drya_:

Sequence, based on SEQRES records: (download)

>d1drya_ b.82.2.2 (A:) Clavaminate synthase {Streptomyces clavuligerus [TaxId: 1901]}
tsvdctaygpelralaarlprtpradlyafldaahtaaaslpgalataldtfnaegsedg
hlllrglpveadadlpttpsstpapedrslltmeamlglvgrrlglhtgyrelrsgtvyh
dvypspgahhlssetsetllefhtemayhrlqpnyvmlacsradhertaatlvasvrkal
plldertrarlldrrmpccvdvafrggvddpgaiaqvkplygdaddpflgydrellaped
padkeavaalskaldevteavylepgdllivdnfrtthartpfsprwdgkdrwlhrvyir
tdrngqlsggeragdvvaftprg

Sequence, based on observed residues (ATOM records): (download)

>d1drya_ b.82.2.2 (A:) Clavaminate synthase {Streptomyces clavuligerus [TaxId: 1901]}
tsvdctaygpelralaarlprtpradlyafldaahtaaaslpgalataldtfnaegsedg
hlllrglpveadadlpttpsstpapedrslltmeamlglvgrrlglhtgyrelrsgtvyh
dvypspgahhlssetsetllefhtemayhrlqpnyvmlacsradhertaatlvasvrkal
plldertrarlldrrmpccvdvafrgiaqvkplygdaddpflgydrellapedpadkeav
aalskaldevteavylepgdllivdnfrtthartpfsprwdgkdrwlhrvyirtdrngql
sggeragdvvaftprg

SCOPe Domain Coordinates for d1drya_:

Click to download the PDB-style file with coordinates for d1drya_.
(The format of our PDB-style files is described here.)

Timeline for d1drya_: