Lineage for d1dcsa_ (1dcs A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2070787Family b.82.2.1: Penicillin synthase-like [51198] (5 protein domains)
    common fold is rather distorted
  6. 2070796Protein Deacetoxycephalosporin C synthase [51201] (1 species)
  7. 2070797Species Streptomyces clavuligerus [TaxId:1901] [51202] (17 PDB entries)
    Uniprot P18548
  8. 2070798Domain d1dcsa_: 1dcs A: [28124]
    complexed with so4

Details for d1dcsa_

PDB Entry: 1dcs (more details), 1.3 Å

PDB Description: deacetoxycephalosporin c synthase from s. clavuligerus
PDB Compounds: (A:) deacetoxycephalosporin c synthase

SCOPe Domain Sequences for d1dcsa_:

Sequence, based on SEQRES records: (download)

>d1dcsa_ b.82.2.1 (A:) Deacetoxycephalosporin C synthase {Streptomyces clavuligerus [TaxId: 1901]}
mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdlvidffehgse
aekravtspvptmrrgftglesestaqitntgsysdysmcysmgtadnlfpsgdferiwt
qyfdrqytasravarevlratgtepdggveafldcepllrfryfpqvpehrsaeeqplrm
aphydlsmvtliqqtpcangfvslqaevggaftdlpyrpdavlvfcgaiatlvtggqvka
prhhvaaprrdqiagssrtssvfflrpnadftfsvplarecgfdvsldgetatfqdwigg
nyvnirrtska

Sequence, based on observed residues (ATOM records): (download)

>d1dcsa_ b.82.2.1 (A:) Deacetoxycephalosporin C synthase {Streptomyces clavuligerus [TaxId: 1901]}
mdttvptfslaelqqglhqdefrrclrdkglfyltdcgltdtelksakdlvidffehgse
aekravtspvptmrrgftglsmcysmgtadnlfpsgdferiwtqyfdrqytasravarev
lratgtepdggveafldcepllrfryfpqlrmaphydlsmvtliqqtpcangfvslqaev
ggaftdlpyrpdavlvfcgaiatlvtggqvkaprhhvaapiagssrtssvfflrpnadft
fsvplarecgfdvsldgetatfqdwiggnyvnirrtska

SCOPe Domain Coordinates for d1dcsa_:

Click to download the PDB-style file with coordinates for d1dcsa_.
(The format of our PDB-style files is described here.)

Timeline for d1dcsa_: