Lineage for d1ipsb_ (1ips B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 470810Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 470811Family b.82.2.1: Penicillin synthase-like [51198] (3 proteins)
    common fold is rather distorted
  6. 470831Protein Isopenicillin N synthase [51199] (1 species)
  7. 470832Species Emericella nidulans [TaxId:162425] [51200] (15 PDB entries)
  8. 470848Domain d1ipsb_: 1ips B: [28123]

Details for d1ipsb_

PDB Entry: 1ips (more details), 2.5 Å

PDB Description: isopenicillin n synthase from aspergillus nidulans (manganese complex)

SCOP Domain Sequences for d1ipsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ipsb_ b.82.2.1 (B:) Isopenicillin N synthase {Emericella nidulans}
vskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhm
sitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpt
hevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlas
vvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdie
addtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepn
gksdreplsygdylqnglvslinkngqt

SCOP Domain Coordinates for d1ipsb_:

Click to download the PDB-style file with coordinates for d1ipsb_.
(The format of our PDB-style files is described here.)

Timeline for d1ipsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ipsa_