SCOPe 2.08: Domain d1ipsb_: 1ips B:

Lineage for d1ipsb_ (1ips B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins)
   common fold is rather distorted

6. Protein Isopenicillin N synthase [51199] (3 species)

7. Species Emericella nidulans [TaxId:162425] [51200] (27 PDB entries)
   Uniprot P05326

8. Domain d1ipsb_: 1ips B: [28123]
   complexed with mn

Details for d1ipsb_

PDB Entry: 1ips, 2.5 Å

PDB Description: isopenicillin n synthase from aspergillus nidulans (manganese complex)

PDB Compounds: (B:) isopenicillin n synthase

SCOPe Domain Sequences for d1ipsb_:

Sequence; same for both SEQRES and ATOM records:

>d1ipsb_ b.82.2.1 (B:) Isopenicillin N synthase {Emericella nidulans [TaxId: 162425]}
vskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhm
sitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpt
hevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlas
vvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdie
addtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepn
gksdreplsygdylqnglvslinkngqt

Timeline for d1ipsb_:

• d1ipsb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ipsb_ appears in SCOPe 2.07