Lineage for d1qjfa_ (1qjf A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17821Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies)
  4. 17878Superfamily b.82.2: Clavaminate synthase-like [51197] (2 families) (S)
  5. 17879Family b.82.2.1: Penicillin syntase [51198] (2 proteins)
  6. 17885Protein Isopenicillin N synthase [51199] (1 species)
  7. 17886Species Emericella nidulans [TaxId:162425] [51200] (6 PDB entries)
  8. 17889Domain d1qjfa_: 1qjf A: [28119]

Details for d1qjfa_

PDB Entry: 1qjf (more details), 1.4 Å

PDB Description: isopenicillin n synthase from aspergillus nidulans (monocyclic sulfoxide - fe complex)

SCOP Domain Sequences for d1qjfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjfa_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans}
vskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhm
sitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpt
hevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlas
vvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdie
addtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepn
gksdreplsygdylqnglvslinkngqt

SCOP Domain Coordinates for d1qjfa_:

Click to download the PDB-style file with coordinates for d1qjfa_.
(The format of our PDB-style files is described here.)

Timeline for d1qjfa_: