Lineage for d1bk0a_ (1bk0 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 810188Superfamily b.82.2: Clavaminate synthase-like [51197] (13 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 810189Family b.82.2.1: Penicillin synthase-like [51198] (4 proteins)
    common fold is rather distorted
  6. 810219Protein Isopenicillin N synthase [51199] (1 species)
  7. 810220Species Emericella nidulans [TaxId:162425] [51200] (29 PDB entries)
    Uniprot P05326
  8. 810228Domain d1bk0a_: 1bk0 A: [28118]
    complexed with acv, fe, so4

Details for d1bk0a_

PDB Entry: 1bk0 (more details), 1.3 Å

PDB Description: isopenicillin n synthase from aspergillus nidulans (acv-fe complex)
PDB Compounds: (A:) isopenicillin n synthase

SCOP Domain Sequences for d1bk0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bk0a_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans [TaxId: 162425]}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

SCOP Domain Coordinates for d1bk0a_:

Click to download the PDB-style file with coordinates for d1bk0a_.
(The format of our PDB-style files is described here.)

Timeline for d1bk0a_: