Lineage for d1bk0__ (1bk0 -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567256Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 567527Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 567528Family b.82.2.1: Penicillin synthase-like [51198] (3 proteins)
    common fold is rather distorted
  6. 567552Protein Isopenicillin N synthase [51199] (1 species)
  7. 567553Species Emericella nidulans [TaxId:162425] [51200] (15 PDB entries)
  8. 567556Domain d1bk0__: 1bk0 - [28118]
    complexed with acv, fe, so4

Details for d1bk0__

PDB Entry: 1bk0 (more details), 1.3 Å

PDB Description: isopenicillin n synthase from aspergillus nidulans (acv-fe complex)

SCOP Domain Sequences for d1bk0__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bk0__ b.82.2.1 (-) Isopenicillin N synthase {Emericella nidulans}
svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh
msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp
thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla
svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi
eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep
ngksdreplsygdylqnglvslinkngqt

SCOP Domain Coordinates for d1bk0__:

Click to download the PDB-style file with coordinates for d1bk0__.
(The format of our PDB-style files is described here.)

Timeline for d1bk0__: