Lineage for d1qjea_ (1qje A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381159Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 381367Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 381368Family b.82.2.1: Penicillin synthase-like [51198] (3 proteins)
    common fold is rather distorted
  6. 381388Protein Isopenicillin N synthase [51199] (1 species)
  7. 381389Species Emericella nidulans [TaxId:162425] [51200] (14 PDB entries)
  8. 381391Domain d1qjea_: 1qje A: [28117]
    Ip1 - Fe complex
    complexed with acv, fe2, ip1, so4

Details for d1qjea_

PDB Entry: 1qje (more details), 1.35 Å

PDB Description: isopenicillin n synthase from aspergillus nidulans (ip1 - fe complex)

SCOP Domain Sequences for d1qjea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjea_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans}
skanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefhms
itpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktpth
evnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtlasv
vlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdiea
ddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprepng
ksdreplsygdylqnglvslinkngqt

SCOP Domain Coordinates for d1qjea_:

Click to download the PDB-style file with coordinates for d1qjea_.
(The format of our PDB-style files is described here.)

Timeline for d1qjea_: