Lineage for d1eyba_ (1eyb A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070231Family b.82.1.4: Homogentisate dioxygenase [51194] (1 protein)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the C-terminal domain similar to the metal-binding site of germin
    automatically mapped to Pfam PF04209
  6. 2070232Protein Homogentisate dioxygenase [51195] (1 species)
  7. 2070233Species Human (Homo sapiens) [TaxId:9606] [51196] (2 PDB entries)
  8. 2070235Domain d1eyba_: 1eyb A: [28115]

Details for d1eyba_

PDB Entry: 1eyb (more details), 1.9 Å

PDB Description: crystal structure of apo human homogentisate dioxygenase
PDB Compounds: (A:) homogentisate 1,2-dioxygenase

SCOPe Domain Sequences for d1eyba_:

Sequence, based on SEQRES records: (download)

>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]}
aelkyisgfgnecssedprcpgslpegqnnpqvcpynlyaeqlsgsaftcprstnkrswl
yrilpsvshkpfesideghvthnwdevdpdpnqlrwkpfeipkasqkkvdfvsglhtlcg
agdiksnnglaihiflcntsmenrcfynsdgdflivpqkgnlliytefgkmlvqpneicv
iqrgmrfsidvfeetrgyilevygvhfelpdlgpiganglanprdflipiawyedrqvpg
gytvinkyqgklfaakqdvspfnvvawhgnytpykynlknfmvinsvafdhadpsiftvl
taksvrpgvaiadfvifpprwgvadktfrppyyhrncmsefmglirghyeakqggflpgg
gslhstmtphgpdadcfekaskvklaperiadgtmafmfesslslavtkwglkasrclde
nyhkcweplkshftpnsrn

Sequence, based on observed residues (ATOM records): (download)

>d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]}
aelkyisgfgnecssedprcpgslpegqnnpqvcpynlyaeqlsgsaftcprstnkrswl
yrilpsvshkpfesideghvthnwdevdpdpnqlrwkpfeipkasqkkvdfvsglhtlcg
agdiksnnglaihiflcntsmenrcfynsdgdflivpqkgnlliytefgkmlvqpneicv
iqrgmrfsidvfeetrgyilevygvhfelpdlgpiganglanprdflipiawyedrqvpg
gytvinkyqgklfaakqdvspfnvvawhgnytpykynlknfmvinsvafdhadpsiftvl
taksvrpgvaiadfvifpprwgvadktfrppyyhrncmsefmglirgflpgggslhstmt
phgpdadcfekaskvklaperiadgtmafmfesslslavtkwglkasrlkshftpnsrn

SCOPe Domain Coordinates for d1eyba_:

Click to download the PDB-style file with coordinates for d1eyba_.
(The format of our PDB-style files is described here.)

Timeline for d1eyba_: