Lineage for d1pmia_ (1pmi A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814698Family b.82.1.3: Type I phosphomannose isomerase [51191] (4 proteins)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin
  6. 2814703Protein Phosphomannose isomerase [51192] (1 species)
  7. 2814704Species Yeast (Candida albicans) [TaxId:5476] [51193] (1 PDB entry)
    contains insert all-alpha subdomain; residues 152-266
  8. 2814705Domain d1pmia_: 1pmi A: [28114]
    complexed with zn

Details for d1pmia_

PDB Entry: 1pmi (more details), 1.7 Å

PDB Description: Candida Albicans Phosphomannose Isomerase
PDB Compounds: (A:) phosphomannose isomerase

SCOPe Domain Sequences for d1pmia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]}
sseklfriqcgyqnydwgkigsssavaqfvhnsdpsitidetkpyaelwmgthpsvpska
idlnnqtlrdlvtakpqeylgesiitkfgsskelpflfkvlsiekvlsiqahpdkklgaq
lhaadpknypddnhkpemaiavtdfegfcgfkpldqlaktlatvpelneiigqelvdefi
sgiklpaevgsqddvnnrkllqkvfgklmntdddvikqqtakllertdrepqvfkdidsr
lpeliqrlnkqfpndiglfcgclllnhvglnkgeamflqakdphayisgdiiecmaasdn
vvragftpkfkdvknlvemltysyesvekqkmplqefprskgdavksvlydppiaefsvl
qtifdkskggkqvieglngpsiviatngkgtiqitgddstkqkidtgyvffvapgssiel
tadsanqdqdfttyrafvea

SCOPe Domain Coordinates for d1pmia_:

Click to download the PDB-style file with coordinates for d1pmia_.
(The format of our PDB-style files is described here.)

Timeline for d1pmia_: