![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.3: Type I phosphomannose isomerase [51191] (4 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin |
![]() | Protein Phosphomannose isomerase [51192] (1 species) |
![]() | Species Yeast (Candida albicans) [TaxId:5476] [51193] (1 PDB entry) contains insert all-alpha subdomain; residues 152-266 |
![]() | Domain d1pmia_: 1pmi A: [28114] complexed with zn |
PDB Entry: 1pmi (more details), 1.7 Å
SCOPe Domain Sequences for d1pmia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} sseklfriqcgyqnydwgkigsssavaqfvhnsdpsitidetkpyaelwmgthpsvpska idlnnqtlrdlvtakpqeylgesiitkfgsskelpflfkvlsiekvlsiqahpdkklgaq lhaadpknypddnhkpemaiavtdfegfcgfkpldqlaktlatvpelneiigqelvdefi sgiklpaevgsqddvnnrkllqkvfgklmntdddvikqqtakllertdrepqvfkdidsr lpeliqrlnkqfpndiglfcgclllnhvglnkgeamflqakdphayisgdiiecmaasdn vvragftpkfkdvknlvemltysyesvekqkmplqefprskgdavksvlydppiaefsvl qtifdkskggkqvieglngpsiviatngkgtiqitgddstkqkidtgyvffvapgssiel tadsanqdqdfttyrafvea
Timeline for d1pmia_: