Lineage for d1cawa_ (1caw A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17821Fold b.82: Double-stranded beta-helix [51181] (5 superfamilies)
  4. 17822Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 17833Family b.82.1.2: Germin/Seed storage 7S protein [51187] (1 protein)
  6. 17834Protein Seed storage 7S protein [51188] (2 species)
  7. 17844Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. 17867Domain d1cawa_: 1caw A: [28112]

Details for d1cawa_

PDB Entry: 1caw (more details), 2.6 Å

PDB Description: determination of three crystal structures of canavalin by molecular replacement

SCOP Domain Sequences for d1cawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cawa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
aqnnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphh
sdsdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfa
itfrrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
k

SCOP Domain Coordinates for d1cawa_:

Click to download the PDB-style file with coordinates for d1cawa_.
(The format of our PDB-style files is described here.)

Timeline for d1cawa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cawb_