Lineage for d1caxf_ (1cax F:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 470566Superfamily b.82.1: RmlC-like cupins [51182] (13 families) (S)
  5. 470598Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)
  6. 470617Protein Seed storage 7S protein [51188] (6 species)
    duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer
  7. 470652Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. 470666Domain d1caxf_: 1cax F: [28109]

Details for d1caxf_

PDB Entry: 1cax (more details), 2.6 Å

PDB Description: determination of three crystal structures of canavalin by molecular replacement

SCOP Domain Sequences for d1caxf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1caxf_ b.82.1.2 (F:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
gqpr

SCOP Domain Coordinates for d1caxf_:

Click to download the PDB-style file with coordinates for d1caxf_.
(The format of our PDB-style files is described here.)

Timeline for d1caxf_: