SCOP 1.61: Domain d1caxe_: 1cax E:

Lineage for d1caxe_ (1cax E:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)

4. Superfamily b.82.1: RmlC-like cupins [51182] (5 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (4 species)

7. Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)

8. Domain d1caxe_: 1cax E: [28108]

Details for d1caxe_

PDB Entry: 1cax, 2.6 Å

PDB Description: determination of three crystal structures of canavalin by molecular replacement

SCOP Domain Sequences for d1caxe_:

Sequence; same for both SEQRES and ATOM records:

>d1caxe_ b.82.1.2 (E:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
aqnnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphh
sdsdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfa
itfrrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
k

Timeline for d1caxe_:

• d1caxe_ first appeared (with stable ids) in SCOP 1.55
  
• d1caxe_ appears in SCOP 1.59
  
• d1caxe_ appears in SCOP 1.63
  
• d1caxe_ appears in the current release, SCOPe 2.08