SCOP 1.61: Domain d1caub_: 1cau B:

Lineage for d1caub_ (1cau B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)

4. Superfamily b.82.1: RmlC-like cupins [51182] (5 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (4 species)

7. Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)

8. Domain d1caub_: 1cau B: [28103]

Details for d1caub_

PDB Entry: 1cau, 2.3 Å

PDB Description: determination of three crystal structures of canavalin by molecular replacement

SCOP Domain Sequences for d1caub_:

Sequence; same for both SEQRES and ATOM records:

>d1caub_ b.82.1.2 (B:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
tlssqdkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphyns
ratvilvanegraevelvgleqqqqqglesmqlrryaatlsegdiivipssfpvalkaas
dlnmvgigvnaennernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvd
gqpr

Timeline for d1caub_:

• d1caub_ first appeared (with stable ids) in SCOP 1.55
  
• d1caub_ appears in SCOP 1.59
  
• d1caub_ appears in SCOP 1.63
  
• d1caub_ appears in the current release, SCOPe 2.08