| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
| Family b.82.1.2: Germin/Seed storage 7S protein [51187] (5 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein Seed storage 7S protein [51188] (6 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
| Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (11 PDB entries) |
| Domain d1dgra_: 1dgr A: [28096] complexed with po4 |
PDB Entry: 1dgr (more details), 2.6 Å
SCOPe Domain Sequences for d1dgra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dgra_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]}
nnpylfrsnkfltlfknqhgslrllqrfnedteklenlrdyrvleycskpntlllphhsd
sdllvlvlegqailvlvnpdgrdtykldqgdaikiqagtpfylinpdnnqnlrilkfait
frrpgtvedfflsstkrlpsylsafsknfleasydspydeieqtllqeeqegvivkmp
Timeline for d1dgra_: