Lineage for d1dgw.1 (1dgw X:,Y:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63617Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 63618Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 63629Family b.82.1.2: Germin/Seed storage 7S protein [51187] (2 proteins)
  6. 63633Protein Seed storage 7S protein [51188] (2 species)
  7. 63643Species Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId:3823] [51190] (8 PDB entries)
  8. 63644Domain d1dgw.1: 1dgw X:,Y: [28091]

Details for d1dgw.1

PDB Entry: 1dgw (more details), 1.7 Å

PDB Description: Structure of the rhombohedral crystal of canavalin from jack bean

SCOP Domain Sequences for d1dgw.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dgw.1 b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin}
dkpfnlrsrdpiysnnygklyeitpeknsqlrdldillnclqmnegalfvphynsratvi
lvanegraevelvgleXqlrryaatlsegdiivipssfpvalkaasdlnmvgigvnaenn
ernflaghkenvirqiprqvsdltfpgsgeeveellenqkesyfvdgqp

SCOP Domain Coordinates for d1dgw.1:

Click to download the PDB-style file with coordinates for d1dgw.1.
(The format of our PDB-style files is described here.)

Timeline for d1dgw.1: