Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (24 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) |
Protein Seed storage 7S protein [51188] (6 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries) |
Domain d1phsa2: 1phs A:220-381 [28089] CA-atoms only |
PDB Entry: 1phs (more details), 3 Å
SCOP Domain Sequences for d1phsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1phsa2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} ntignefgnltertdnslnvlissiemeegalfvphyyskaivilvvnegeahvelvgpk gnketleyesyraelskddvfvipaaypvaikatsnvnftgfginannnnrnllagktdn vissigraldgkdvlgltfsgsgdevmklinkqsgsyfvdah
Timeline for d1phsa2: