Class b: All beta proteins [48724] (149 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (16 families) |
Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins) |
Protein Seed storage 7S protein [51188] (6 species) duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer |
Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries) |
Domain d1phs_1: 1phs 11-212 [28088] |
PDB Entry: 1phs (more details), 3 Å
SCOP Domain Sequences for d1phs_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1phs_1 b.82.1.2 (11-212) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin} dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg vivnidseqikelskhaksssr
Timeline for d1phs_1: