Lineage for d1phs_1 (1phs 11-212)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63617Fold b.82: Double-stranded beta-helix [51181] (6 superfamilies)
  4. 63618Superfamily b.82.1: RmlC-like [51182] (4 families) (S)
  5. 63629Family b.82.1.2: Germin/Seed storage 7S protein [51187] (2 proteins)
  6. 63633Protein Seed storage 7S protein [51188] (2 species)
  7. 63634Species French bean (Phaseolus vulgaris), phaseolin [TaxId:3885] [51189] (2 PDB entries)
  8. 63641Domain d1phs_1: 1phs 11-212 [28088]

Details for d1phs_1

PDB Entry: 1phs (more details), 3 Å

PDB Description: the three-dimensional structure of the seed storage protein phaseolin at 3 angstroms resolution

SCOP Domain Sequences for d1phs_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1phs_1 b.82.1.2 (11-212) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin}
dnpfyfnsdnswntlfknqyghirvlqrfdqqskrlqnledyrlvefrskpetlllpqqa
daelllvvrsgsailvlvkpddrreyffltsdnpifsdhqkipagtifylvnpdpkedlr
iiqlampvnnpqihefflssteaqqsylqefskhileasfnskfeeinrvlfeeegqqeg
vivnidseqikelskhaksssr

SCOP Domain Coordinates for d1phs_1:

Click to download the PDB-style file with coordinates for d1phs_1.
(The format of our PDB-style files is described here.)

Timeline for d1phs_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1phs_2